PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_7A5C5CCCB.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 360aa    MW: 35747.5 Da    PI: 9.6935
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_7A5C5CCCB.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-3844104262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +e  lkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+++
  Traes_5BL_7A5C5CCCB.1  44 PEPGLKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGTLRNVPVGGGCRRNKRTK 104
                            56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3728102IPR003851Zinc finger, Dof-type
PfamPF027013.3E-3248102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.44148102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGSPVALSGA GGGGGGAGGG LTGGAVVRPG SMTDKARMAK IPQPEPGLKC PRCESTNTKF  60
CYFNNYSLTQ PRHFCKTCRR YWTRGGTLRN VPVGGGCRRN KRTKSSKSSS SAASASGGGT  120
SSSTTSSTTT AGGGNGNGST AAGAAGAMMS SQGQGHAQMP FFGSLHPLGA GSGDHYGTGA  180
SRLGFPGLIN SLDPVDYQLG GGGAAAAAMA LSEQWRLPQM QQFPFFGRAD GMHQQQQQMA  240
GLYPFDATDA SGFAGEMMGG VGGSKQLVPG SAGLITQLAS VKMEDNPPSN NSMAGAASAR  300
EFLGLPGNIQ FWGGGNNGAG GNENGGSHSS GTVAPGGAGG GGGWVDQLPG FNSSSSGNIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843490.0AM084349.1 Hordeum vulgare subsp. vulgare dof1 gene for dof zinc finger protein 1, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981250.11e-107PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLW5FDL70.0W5FDL7_WHEAT; Uncharacterized protein
STRINGMLOC_17236.11e-171(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-43DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]